February 29, 2024

Human Monoclonal

Monoclonal PP2A alpha and beta Antibody

AMM03147G 0.1ml
EUR 580.8
Description: A Monoclonal antibody against Human PP2A alpha and beta. The antibodies are raised in Mouse. This antibody is applicable in WB, IP

Human Monoclonal Laboratories manufactures the human monoclonal reagents distributed by Genprice. The Human Monoclonal reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact human monoclonal. Other Human products are available in stock. Specificity: Human Category: Monoclonal

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 480
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 390.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 488.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 565.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 594.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 633.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 655.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 680.

Biology information

Human CD45RA Monoclonal antibody

45RAPC7-100T 100 test
EUR 358.6

Human LAMBDA Monoclonal antibody

LA2-100T 100 test
EUR 445.5

Human IGF-I monoclonal antibody

MAM1 500 µg
EUR 358.8

Human TCR CB1 Monoclonal antibody

JOVIDY634 100 test
EUR 611.6

Human TCR CB1 Monoclonal antibody

JOVIF 100 test
EUR 463.1

Human TGF-β2 monoclonal antibody

MAB1 500 µg
EUR 358.8

Pepsin (PP) Monoclonal Antibody (Human)

4-MAA632Hu22
  • EUR 310.80
  • EUR 3249.60
  • EUR 804.00
  • EUR 393.60
  • EUR 262.80
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Mouse monoclonal antibody against Human Pepsin (PP)

Titin (TTN) Monoclonal Antibody (Human)

4-MAB667Hu21
  • EUR 260.40
  • EUR 2457.60
  • EUR 624.00
  • EUR 321.60
  • EUR 241.20
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Mouse monoclonal antibody against Human Titin (TTN)

Klotho (KL) Monoclonal Antibody (Human)

4-MAH757Hu21
  • EUR 306.00
  • EUR 3170.40
  • EUR 786.00
  • EUR 386.40
  • EUR 260.40
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Mouse monoclonal antibody against Human Klotho (KL)

Human IGFBP-3 monoclonal antibody

MAK1 200 µg
EUR 358.8

Zyxin (ZYX) Monoclonal Antibody (Human)

4-MAC235Hu21
  • EUR 306.00
  • EUR 3170.40
  • EUR 786.00
  • EUR 386.40
  • EUR 260.40
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Mouse monoclonal antibody against Human Zyxin (ZYX)

anti-XPA (human) antibody, monoclonal

70-031 50ug
EUR 496.8
Description: The anti-XPA (human) antibody, monoclonal is available in Europe and for worldwide shipping via Gentaur.

Midkine (MK) Monoclonal Antibody (Human)

4-MAA631Hu22
  • EUR 289.20
  • EUR 2900.40
  • EUR 724.80
  • EUR 361.20
  • EUR 253.20
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Mouse monoclonal antibody against Human Midkine (MK)

Leptin (LEP) Monoclonal Antibody (Human)

4-MAA084Hu21
  • EUR 285.60
  • EUR 2845.20
  • EUR 711.60
  • EUR 356.40
  • EUR 252.00
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Mouse monoclonal antibody against Human Leptin (LEP)

Leptin (LEP) Monoclonal Antibody (Human)

4-MAA084Hu22
  • EUR 285.60
  • EUR 2845.20
  • EUR 711.60
  • EUR 356.40
  • EUR 252.00
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Mouse monoclonal antibody against Human Leptin (LEP)

Human Protein C Monoclonal Antibody

65010-05111 100 ug
EUR 215

Human Protein S Monoclonal Antibody

65014-05111 100 ug
EUR 215