May 29, 2024

Iga Monoclonal

Monoclonal PP2A alpha and beta Antibody

AMM03147G 0.1ml
EUR 580.8
Description: A Monoclonal antibody against Human PP2A alpha and beta. The antibodies are raised in Mouse. This antibody is applicable in WB, IP

Iga Monoclonal Laboratories manufactures the iga monoclonal reagents distributed by Genprice. The Iga Monoclonal reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact iga monoclonal. Other Iga products are available in stock. Specificity: Iga Category: Monoclonal

JBS True Blue

300 µl
EUR 16
Description: JBS True Blue

Monoclonal PP2A alpha and beta Antibody

EUR 580.8
Description: A Monoclonal antibody against Human PP2A alpha and beta. The antibodies are raised in Mouse. This antibody is applicable in WB, IP

Monoclonal antibody for SUR1 and SUR2B

EUR 423.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated.

Monoclonal antibody for SUR1 and SUR2B

EUR 480
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 390.

Monoclonal antibody for SUR1 and SUR2B

EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 488.

Monoclonal antibody for SUR1 and SUR2B

EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 565.

Monoclonal antibody for SUR1 and SUR2B

EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 594.

Biology information

Mouse anti Human IgA Monoclonal Antibody

MBS460953-01mg 0.1mg
EUR 280

Mouse anti Human IgA Monoclonal Antibody

MBS460953-5x01mg 5x0.1mg
EUR 1215

Mouse anti Human IgA Monoclonal Antibody

MBS460954-01mg 0.1mg
EUR 280

Mouse anti Human IgA Monoclonal Antibody

MBS460954-5x01mg 5x0.1mg
EUR 1215

Human IgA (Total IgA) mouse monoclonal antibody, clone A909

1A1-A909 1 mg Ask for price

Mouse Anti Bovine Iga Monoclonal Antibody

DMABT-51899MB 0.25 mg
EUR 889.2

Monoclonal Anti-human IgA antibody.

TMI012-0.25MG 0.25mg
EUR 169
Description: Specific to human IgA, no cross reaction with IgE, IgG, and IgM. This antibody can be paired with TMI013.

Monoclonal Anti-human IgA antibody.

TMI012-1MG 1mg
EUR 569
Description: Specific to human IgA, no cross reaction with IgE, IgG, and IgM. This antibody can be paired with TMI013.

Monoclonal Anti-human IgA antibody.

TMI013-0.25MG 0.25mg
EUR 169
Description: Specific to human IgA, no cross reaction with IgE, IgG, and IgM. This antibody can be paired with TMI012.

Monoclonal Anti-human IgA antibody.

TMI013-1MG 1mg
EUR 569
Description: Specific to human IgA, no cross reaction with IgE, IgG, and IgM. This antibody can be paired with TMI012.

Mouse Anti Chicken Iga Monoclonal Antibody

DMABT-51958MC 0.25 mg
EUR 889.2

CD79a Recombinant monoclonal antibody (IGA/1790R)

MBS566843-01mg 0.1mg
EUR 615

CD79a Recombinant monoclonal antibody (IGA/1790R)

MBS566843-5x01mg 5x0.1mg
EUR 2720

HRP*Monoclonal Mouse Anti- Human IgA

C030249-10ml 10ml
EUR 2148

HRP*Monoclonal Mouse Anti- Human IgA

C030249-1ml 1ml
EUR 424.8

FITC*Monoclonal Mouse Anti- Human IgA

C030649-10ml 10ml
EUR 2148

FITC*Monoclonal Mouse Anti- Human IgA

C030649-1ml 1ml
EUR 373.2