March 19, 2025

Iga Monoclonalapathy

Monoclonal antibody for SUR1 and SUR2B

SMC-432D 0.1mg
EUR 423.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated.

Iga Monoclonal Laboratories manufactures the iga monoclonalapathy reagents distributed by Genprice. The Iga Monoclonalapathy reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact iga monoclonal. Other Iga products are available in stock. Specificity: Iga Category: Monoclonalapathy

True Blue Chloride

100mg
EUR 11200
Description: 71431-30-6

True north Cryobox1.5/2mLNatural

PK10
EUR 129.6

True Blue Diaceturate Salt

100mg
EUR 15000
Description: 108321-12-6

True Blue (TB) Diaceturate Salt

1mg Ask for price
Description: 108321-12-6

True Blue (TB) Diaceturate Salt

5mg Ask for price
Description: 108321-12-6

Porcine True insulin ELISA kit

96T
EUR 700
Description: ELISA

Goat True insulin ELISA kit

96T
EUR 700
Description: ELISA

Biology information

Mouse anti Human IgA Monoclonal Antibody

MBS460954-01mg 0.1mg
EUR 280

Mouse anti Human IgA Monoclonal Antibody

MBS460954-5x01mg 5x0.1mg
EUR 1215

Mouse Anti Bovine Iga Monoclonal Antibody

DMABT-51899MB 0.25 mg
EUR 546
Description: Mouse

Monoclonal Antibody to Human IgA

MBS465016-01mg 0.1mg
EUR 360

Monoclonal Antibody to Human IgA

MBS410046-1mg 1mg
EUR 290

Mouse Anti Chicken Iga Monoclonal Antibody

DMABT-51958MC 0.25 mg
EUR 546
Description: Mouse

Monoclonal Mouse Anti-Human IgA

CE10208-10mg 10 mg
EUR 1200

Monoclonal Mouse Anti-Human IgA

CE10208-1mg 1 mg
EUR 200

Monoclonal Mouse Anti-Human IgA

C010208-10mg 10mg
EUR 1336.8

Monoclonal Mouse Anti-Human IgA

C010208-1mg 1mg
EUR 322.8

CD79a Recombinant monoclonal antibody (IGA/1790R)

MBS566843-01mg 0.1mg
EUR 615

CD79a Recombinant monoclonal antibody (IGA/1790R)

MBS566843-5x01mg 5x0.1mg
EUR 2720

IgA (14V16) Rabbit Monoclonal Antibody

E28M5108 100ul
EUR 295

Monoclonal Anti-human IgA antibody.

TMI012-0.25MG 0.25mg
EUR 169
Description: Specific to human IgA, no cross reaction with IgE, IgG, and IgM. This antibody can be paired with TMI013.

Monoclonal Anti-human IgA antibody.

TMI012-1MG 1mg
EUR 569
Description: Specific to human IgA, no cross reaction with IgE, IgG, and IgM. This antibody can be paired with TMI013.

Monoclonal Anti-human IgA antibody.

TMI013-0.25MG 0.25mg
EUR 169
Description: Specific to human IgA, no cross reaction with IgE, IgG, and IgM. This antibody can be paired with TMI012.

Monoclonal Anti-human IgA antibody.

TMI013-1MG 1mg
EUR 569
Description: Specific to human IgA, no cross reaction with IgE, IgG, and IgM. This antibody can be paired with TMI012.