Monoclonal antibody for SUR1 and SUR2B |
|
SMC-432D |
Stressmarq |
0.1mg |
EUR 423.6 |
|
|
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated. |
Iga Monoclonal Laboratories manufactures the iga monoclonalapathy reagents distributed by Genprice. The Iga Monoclonalapathy reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact iga monoclonal. Other Iga products are available in stock. Specificity: Iga Category: Monoclonalapathy
Porcine True insulin ELISA kit |
|
BlueGene |
96T |
EUR 700 |
|
Description: ELISA |
Goat True insulin ELISA kit |
|
BlueGene |
96T |
EUR 700 |
|
Description: ELISA |
Biology information
Mouse anti Human IgA Monoclonal Antibody |
|
MBS460954-01mg |
MyBiosource |
0.1mg |
EUR 280 |
Mouse anti Human IgA Monoclonal Antibody |
|
MBS460954-5x01mg |
MyBiosource |
5x0.1mg |
EUR 1215 |
Mouse Anti Bovine Iga Monoclonal Antibody |
|
DMABT-51899MB |
Creative Diagnostics |
0.25 mg |
EUR 546 |
|
|
|
Description: Mouse |
Monoclonal Antibody to Human IgA |
|
MBS465016-01mg |
MyBiosource |
0.1mg |
EUR 360 |
Monoclonal Antibody to Human IgA |
|
MBS410046-1mg |
MyBiosource |
1mg |
EUR 290 |
Mouse Anti Chicken Iga Monoclonal Antibody |
|
DMABT-51958MC |
Creative Diagnostics |
0.25 mg |
EUR 546 |
|
|
|
Description: Mouse |
Monoclonal Mouse Anti-Human IgA |
|
CE10208-10mg |
Unibiotest |
10 mg |
EUR 1200 |
Monoclonal Mouse Anti-Human IgA |
|
CE10208-1mg |
Unibiotest |
1 mg |
EUR 200 |
Monoclonal Mouse Anti-Human IgA |
|
C010208-10mg |
Unibiotest |
10mg |
EUR 1336.8 |
Monoclonal Mouse Anti-Human IgA |
|
C010208-1mg |
Unibiotest |
1mg |
EUR 322.8 |
CD79a Recombinant monoclonal antibody (IGA/1790R) |
|
MBS566843-01mg |
MyBiosource |
0.1mg |
EUR 615 |
CD79a Recombinant monoclonal antibody (IGA/1790R) |
|
MBS566843-5x01mg |
MyBiosource |
5x0.1mg |
EUR 2720 |
IgA (14V16) Rabbit Monoclonal Antibody |
|
E28M5108 |
EnoGene |
100ul |
EUR 295 |
Monoclonal Anti-human IgA antibody. |
|
TMI012-0.25MG |
Tribioscience |
0.25mg |
EUR 169 |
|
Description: Specific to human IgA, no cross reaction with IgE, IgG, and IgM. This antibody can be paired with TMI013. |
Monoclonal Anti-human IgA antibody. |
|
TMI012-1MG |
Tribioscience |
1mg |
EUR 569 |
|
Description: Specific to human IgA, no cross reaction with IgE, IgG, and IgM. This antibody can be paired with TMI013. |
Monoclonal Anti-human IgA antibody. |
|
TMI013-0.25MG |
Tribioscience |
0.25mg |
EUR 169 |
|
Description: Specific to human IgA, no cross reaction with IgE, IgG, and IgM. This antibody can be paired with TMI012. |
Monoclonal Anti-human IgA antibody. |
|
TMI013-1MG |
Tribioscience |
1mg |
EUR 569 |
|
Description: Specific to human IgA, no cross reaction with IgE, IgG, and IgM. This antibody can be paired with TMI012. |
