Monoclonal antibody for SUR1 and SUR2B |
SMC-432D |
Stressmarq |
0.1mg |
EUR 423.6 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated. |
Iga Monoclonal Laboratories manufactures the igamonoclonalgammopathy reagents distributed by Genprice. The Igamonoclonalgammopathy reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact iga monoclonal. Other Igamonoclonalgammopathy products are available in stock. Specificity: Igamonoclonalgammopathy Category:
Dog True insulin ELISA kit |
BlueGene |
192 tests |
EUR 1524 |
|
Description: A competitive ELISA for quantitative measurement of Canine True insulin in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Dog True insulin ELISA kit |
BlueGene |
1 plate of 48 wells |
EUR 624 |
|
Description: A competitive ELISA for quantitative measurement of Canine True insulin in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Biology information
Casein Kinase Igamma2 Antibody |
E18-9034-1 |
EnoGene |
50ug/50ul |
EUR 145 |
Description: Available in various conjugation types. |
Casein Kinase Igamma2 Antibody |
E18-9034-2 |
EnoGene |
100ug/100ul |
EUR 225 |
Description: Available in various conjugation types. |
Casein Kinase Igamma1 Antibody |
MBS9602076-01mL |
MyBiosource |
0.1mL |
EUR 260 |
Casein Kinase Igamma1 Antibody |
MBS9602076-02mL |
MyBiosource |
0.2mL |
EUR 305 |
Casein Kinase Igamma1 Antibody |
MBS9602076-5x02mL |
MyBiosource |
5x0.2mL |
EUR 1220 |
Casein Kinase Igamma2 Antibody |
MBS9602077-01mL |
MyBiosource |
0.1mL |
EUR 260 |
Casein Kinase Igamma2 Antibody |
MBS9602077-02mL |
MyBiosource |
0.2mL |
EUR 305 |
Casein Kinase Igamma2 Antibody |
MBS9602077-5x02mL |
MyBiosource |
5x0.2mL |
EUR 1220 |
Anti-Human IgA1 Monoclonal Antibody (9D12) |
MBS1567879-01mg |
MyBiosource |
0.1mg |
EUR 295 |
Anti-Human IgA1 Monoclonal Antibody (9D12) |
MBS1567879-5x01mg |
MyBiosource |
5x0.1mg |
EUR 1045 |
Casein Kinase Igamma1 Blocking Peptide |
AF9033-BP |
Affbiotech |
1mg |
EUR 234 |
Casein Kinase Igamma2 Blocking Peptide |
AF9034-BP |
Affbiotech |
1mg |
EUR 234 |
Casein Kinase Igamma1 Blocking Peptide |
MBS9619531-1mg |
MyBiosource |
1mg |
EUR 380 |
Casein Kinase Igamma1 Blocking Peptide |
MBS9619531-5x1mg |
MyBiosource |
5x1mg |
EUR 1650 |
Casein Kinase Igamma2 Blocking Peptide |
MBS9619532-1mg |
MyBiosource |
1mg |
EUR 380 |
Casein Kinase Igamma2 Blocking Peptide |
MBS9619532-5x1mg |
MyBiosource |
5x1mg |
EUR 1650 |