March 19, 2025

Igamonoclonalgammopathy

Monoclonal antibody for SUR1 and SUR2B

SMC-432D 0.1mg
EUR 423.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated.

Iga Monoclonal Laboratories manufactures the igamonoclonalgammopathy reagents distributed by Genprice. The Igamonoclonalgammopathy reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact iga monoclonal. Other Igamonoclonalgammopathy products are available in stock. Specificity: Igamonoclonalgammopathy Category:

True Blue Chloride

100mg
EUR 11200
Description: 71431-30-6

True north Cryobox1.5/2mLNatural

PK10
EUR 129.6

True Blue Diaceturate Salt

100mg
EUR 15000
Description: 108321-12-6

True Blue (TB) Diaceturate Salt

1mg Ask for price
Description: 108321-12-6

True Blue (TB) Diaceturate Salt

5mg Ask for price
Description: 108321-12-6

Porcine True insulin ELISA kit

96T
EUR 700
Description: ELISA

Goat True insulin ELISA kit

96T
EUR 700
Description: ELISA

Biology information

Casein Kinase Igamma2 Antibody

E18-9034-1 50ug/50ul
EUR 145
Description: Available in various conjugation types.

Casein Kinase Igamma2 Antibody

E18-9034-2 100ug/100ul
EUR 225
Description: Available in various conjugation types.

Casein Kinase Igamma1 Antibody

MBS9602076-01mL 0.1mL
EUR 260

Casein Kinase Igamma1 Antibody

MBS9602076-02mL 0.2mL
EUR 305

Casein Kinase Igamma1 Antibody

MBS9602076-5x02mL 5x0.2mL
EUR 1220

Casein Kinase Igamma2 Antibody

MBS9602077-01mL 0.1mL
EUR 260

Casein Kinase Igamma2 Antibody

MBS9602077-02mL 0.2mL
EUR 305

Casein Kinase Igamma2 Antibody

MBS9602077-5x02mL 5x0.2mL
EUR 1220

Anti-Human IgA1 Monoclonal Antibody (9D12)

MBS1567879-01mg 0.1mg
EUR 295

Anti-Human IgA1 Monoclonal Antibody (9D12)

MBS1567879-5x01mg 5x0.1mg
EUR 1045

Human membrane IgA-mIgA-ELISA Kit

QY-E04132 96T
EUR 450

Casein Kinase Igamma1 Blocking Peptide

AF9033-BP 1mg
EUR 234

Casein Kinase Igamma2 Blocking Peptide

AF9034-BP 1mg
EUR 234

Casein Kinase Igamma1 Blocking Peptide

MBS9619531-1mg 1mg
EUR 380

Casein Kinase Igamma1 Blocking Peptide

MBS9619531-5x1mg 5x1mg
EUR 1650

Casein Kinase Igamma2 Blocking Peptide

MBS9619532-1mg 1mg
EUR 380

Casein Kinase Igamma2 Blocking Peptide

MBS9619532-5x1mg 5x1mg
EUR 1650