February 29, 2024

Ija Monoclonal

Monoclonal PP2A alpha and beta Antibody

AMM03147G 0.1ml
EUR 580.8
Description: A Monoclonal antibody against Human PP2A alpha and beta. The antibodies are raised in Mouse. This antibody is applicable in WB, IP

Iga Monoclonal Laboratories manufactures the ija monoclonal reagents distributed by Genprice. The Ija Monoclonal reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact iga monoclonal. Other Ija products are available in stock. Specificity: Ija Category: Monoclonal

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 423.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 480
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 390.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 488.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 565.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 594.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 633.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 655.

Biology information

Monoclonal T Antibody (monoclonal) (M02), Clone: 5C5

AMM04164G 0.1mg
EUR 580.8
Description: A Monoclonal antibody against Human T (monoclonal) (M02). The antibodies are raised in Mouse and are from clone 5C5. This antibody is applicable in WB, E

Monoclonal ESD Antibody (monoclonal) (M01), Clone: 10

AMM04445G 0.1mg
EUR 580.8
Description: A Monoclonal antibody against Human ESD (monoclonal) (M01). The antibodies are raised in mouse and are from clone 10. This antibody is applicable in WB, E

Monoclonal FH Antibody (monoclonal) (M09), Clone: 3E8

AMM04544G 0.1mg
EUR 580.8
Description: A Monoclonal antibody against Human FH (monoclonal) (M09). The antibodies are raised in mouse and are from clone 3E8. This antibody is applicable in WB and IHC, E

Monoclonal GPT Antibody (monoclonal) (M04), Clone: M1

AMM05205G 0.1mg
EUR 580.8
Description: A Monoclonal antibody against Human GPT (monoclonal) (M04). The antibodies are raised in mouse and are from clone M1. This antibody is applicable in E

Monoclonal ACD Antibody (monoclonal) (M02), Clone: S1

AMM03232G 0.1mg
EUR 580.8
Description: A Monoclonal antibody against Human ACD (monoclonal) (M02). The antibodies are raised in mouse and are from clone S1. This antibody is applicable in WB, IHC and IF, IP, E

Monoclonal CA1 Antibody (monoclonal) (M02), Clone: M2

AMM03310G 0.1mg
EUR 580.8
Description: A Monoclonal antibody against Human CA1 (monoclonal) (M02). The antibodies are raised in mouse and are from clone M2. This antibody is applicable in WB, E

Monoclonal CA1 Antibody (monoclonal) (M05), Clone: M1

AMM03311G 0.05mg
EUR 580.8
Description: A Monoclonal antibody against Human CA1 (monoclonal) (M05). The antibodies are raised in mouse and are from clone M1. This antibody is applicable in WB, IP, E

Monoclonal F3 Antibody (monoclonal) (M01), Clone: 4G4

AMM03509G 0.1mg
EUR 580.8
Description: A Monoclonal antibody against Human F3 (monoclonal) (M01). The antibodies are raised in mouse and are from clone 4G4. This antibody is applicable in WB, IP, E

Monoclonal F8 Antibody (monoclonal) (M03), Clone: 1E9

AMM03510G 0.1mg
EUR 580.8
Description: A Monoclonal antibody against Human F8 (monoclonal) (M03). The antibodies are raised in mouse and are from clone 1E9. This antibody is applicable in E

Monoclonal F9 Antibody (monoclonal) (M01), Clone: 2C9

AMM03511G 0.1mg
EUR 580.8
Description: A Monoclonal antibody against Human F9 (monoclonal) (M01). The antibodies are raised in mouse and are from clone 2C9. This antibody is applicable in WB, IP, E

Monoclonal IF Antibody (monoclonal) (M01), Clone: 1B3

AMM03651G 0.1mg
EUR 580.8
Description: A Monoclonal antibody against Human IF (monoclonal) (M01). The antibodies are raised in mouse and are from clone 1B3. This antibody is applicable in WB, E

Monoclonal AK1 Antibody (monoclonal) (M08), Clone: M1

APG01638G 0.1mg
EUR 580.8
Description: A Monoclonal antibody against Human AK1 (monoclonal) (M08). The antibodies are raised in mouse and are from clone M1. This antibody is applicable in WB and IF, E

Monoclonal CBS Antibody (monoclonal) (M01), Clone: 30

APG02460G 0.1mg
EUR 580.8
Description: A Monoclonal antibody against Human CBS (monoclonal) (M01). The antibodies are raised in mouse and are from clone 30. This antibody is applicable in WB and IHC, IP

Monoclonal LEP Antibody (monoclonal) (M02), Clone: M1

APR08190G 0.1mg
EUR 580.8
Description: A Monoclonal antibody against Human LEP (monoclonal) (M02). The antibodies are raised in mouse and are from clone M1. This antibody is applicable in E

Monoclonal MB Antibody (monoclonal) (M04), Clone: 3F7

APR08355G 0.1mg
EUR 580.8
Description: A Monoclonal antibody against Human MB (monoclonal) (M04). The antibodies are raised in Mouse and are from clone 3F7. This antibody is applicable in WB

Monoclonal MT Antibody (monoclonal) (M01), Clone: 2F2

APR08559G 0.1mg
EUR 580.8
Description: A Monoclonal antibody against Human MT (monoclonal) (M01). The antibodies are raised in mouse and are from clone 2F2. This antibody is applicable in WB and IHC, E

Monoclonal HD Antibody (monoclonal) (M02), Clone: 4G6

APR12332G 0.1mg
EUR 580.8
Description: A Monoclonal antibody against Human HD (monoclonal) (M02). The antibodies are raised in Mouse and are from clone 4G6. This antibody is applicable in WB, E