Monoclonal antibody for SUR1 and SUR2B |
|||
| SMC-432D | Stressmarq | 0.1mg | EUR 423.6 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated. |
|||
Iga Monoclonal Laboratories manufactures the ija monoclonal reagents distributed by Genprice. The Ija Monoclonal reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact iga monoclonal. Other Ija products are available in stock. Specificity: Ija Category: Monoclonal
True Blue Chloride |
||
| Toronto Research Chemicals | 100mg | EUR 11200 |
|
Description: 71431-30-6 |
||
Monoclonal antibody for SUR1 and SUR2B |
||
| Stressmarq | 0.1mg | EUR 423.6 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated. |
||
Monoclonal antibody for SUR1 and SUR2B |
||
| Stressmarq | 0.1mg | EUR 480 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 390. |
||
Monoclonal antibody for SUR1 and SUR2B |
||
| Stressmarq | 0.1mg | EUR 478.8 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 488. |
||
Monoclonal antibody for SUR1 and SUR2B |
||
| Stressmarq | 0.1mg | EUR 478.8 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 565. |
||
Monoclonal antibody for SUR1 and SUR2B |
||
| Stressmarq | 0.1mg | EUR 478.8 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 594. |
||
Monoclonal antibody for SUR1 and SUR2B |
||
| Stressmarq | 0.1mg | EUR 478.8 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 633. |
||
Monoclonal CHP Antibody (monoclonal) (M02), Clone: S2 |
|||
| APR15427G | Leading Biology | 0.1mg | EUR 580.8 |
|
Description: A Monoclonal antibody against Human CHP (monoclonal) (M02). The antibodies are raised in mouse and are from clone S2. This antibody is applicable in WB, E |
|||
Monoclonal AES Antibody (monoclonal) (M02), Clone: 10 |
|||
| APR14861G | Leading Biology | 0.1mg | EUR 580.8 |
|
Description: A Monoclonal antibody against Human AES (monoclonal) (M02). The antibodies are raised in mouse and are from clone 10. This antibody is applicable in E |
|||
Monoclonal ESD Antibody (monoclonal) (M01), Clone: 10 |
|||
| AMM04445G | Leading Biology | 0.1mg | EUR 580.8 |
|
Description: A Monoclonal antibody against Human ESD (monoclonal) (M01). The antibodies are raised in mouse and are from clone 10. This antibody is applicable in WB, E |
|||
Monoclonal FH Antibody (monoclonal) (M09), Clone: 3E8 |
|||
| AMM04544G | Leading Biology | 0.1mg | EUR 580.8 |
|
Description: A Monoclonal antibody against Human FH (monoclonal) (M09). The antibodies are raised in mouse and are from clone 3E8. This antibody is applicable in WB and IHC, E |
|||
Monoclonal GPT Antibody (monoclonal) (M04), Clone: M1 |
|||
| AMM05205G | Leading Biology | 0.1mg | EUR 580.8 |
|
Description: A Monoclonal antibody against Human GPT (monoclonal) (M04). The antibodies are raised in mouse and are from clone M1. This antibody is applicable in E |
|||
Monoclonal AK1 Antibody (monoclonal) (M08), Clone: M1 |
|||
| APG01638G | Leading Biology | 0.1mg | EUR 580.8 |
|
Description: A Monoclonal antibody against Human AK1 (monoclonal) (M08). The antibodies are raised in mouse and are from clone M1. This antibody is applicable in WB and IF, E |
|||
Monoclonal CBS Antibody (monoclonal) (M01), Clone: 30 |
|||
| APG02460G | Leading Biology | 0.1mg | EUR 580.8 |
|
Description: A Monoclonal antibody against Human CBS (monoclonal) (M01). The antibodies are raised in mouse and are from clone 30. This antibody is applicable in WB and IHC, IP |
|||
Monoclonal C3 Antibody (monoclonal) (M01), Clone: 5F9 |
|||
| APG03027G | Leading Biology | 0.1mg | EUR 580.8 |
|
Description: A Monoclonal antibody against Human C3 (monoclonal) (M01). The antibodies are raised in mouse and are from clone 5F9. This antibody is applicable in WB and IHC, E |
|||
Monoclonal HD Antibody (monoclonal) (M02), Clone: 4G6 |
|||
| APR12332G | Leading Biology | 0.1mg | EUR 580.8 |
|
Description: A Monoclonal antibody against Human HD (monoclonal) (M02). The antibodies are raised in Mouse and are from clone 4G6. This antibody is applicable in WB, E |
|||
Monoclonal HD Antibody (monoclonal) (M11), Clone: 3F1 |
|||
| APR12333G | Leading Biology | 0.1mg | EUR 580.8 |
|
Description: A Monoclonal antibody against Human HD (monoclonal) (M11). The antibodies are raised in mouse and are from clone 3F1. This antibody is applicable in WB and IHC, E |
|||
Monoclonal ACD Antibody (monoclonal) (M02), Clone: S1 |
|||
| AMM03232G | Leading Biology | 0.1mg | EUR 580.8 |
|
Description: A Monoclonal antibody against Human ACD (monoclonal) (M02). The antibodies are raised in mouse and are from clone S1. This antibody is applicable in WB, IHC and IF, IP, E |
|||
Monoclonal CA1 Antibody (monoclonal) (M02), Clone: M2 |
|||
| AMM03310G | Leading Biology | 0.1mg | EUR 580.8 |
|
Description: A Monoclonal antibody against Human CA1 (monoclonal) (M02). The antibodies are raised in mouse and are from clone M2. This antibody is applicable in WB, E |
|||
Monoclonal CA1 Antibody (monoclonal) (M05), Clone: M1 |
|||
| AMM03311G | Leading Biology | 0.05mg | EUR 580.8 |
|
Description: A Monoclonal antibody against Human CA1 (monoclonal) (M05). The antibodies are raised in mouse and are from clone M1. This antibody is applicable in WB, IP, E |
|||
Monoclonal F3 Antibody (monoclonal) (M01), Clone: 4G4 |
|||
| AMM03509G | Leading Biology | 0.1mg | EUR 580.8 |
|
Description: A Monoclonal antibody against Human F3 (monoclonal) (M01). The antibodies are raised in mouse and are from clone 4G4. This antibody is applicable in WB, IP, E |
|||
Monoclonal F8 Antibody (monoclonal) (M03), Clone: 1E9 |
|||
| AMM03510G | Leading Biology | 0.1mg | EUR 580.8 |
|
Description: A Monoclonal antibody against Human F8 (monoclonal) (M03). The antibodies are raised in mouse and are from clone 1E9. This antibody is applicable in E |
|||
Monoclonal F9 Antibody (monoclonal) (M01), Clone: 2C9 |
|||
| AMM03511G | Leading Biology | 0.1mg | EUR 580.8 |
|
Description: A Monoclonal antibody against Human F9 (monoclonal) (M01). The antibodies are raised in mouse and are from clone 2C9. This antibody is applicable in WB, IP, E |
|||
Monoclonal IF Antibody (monoclonal) (M01), Clone: 1B3 |
|||
| AMM03651G | Leading Biology | 0.1mg | EUR 580.8 |
|
Description: A Monoclonal antibody against Human IF (monoclonal) (M01). The antibodies are raised in mouse and are from clone 1B3. This antibody is applicable in WB, E |
|||