Monoclonal antibody for SUR1 and SUR2B |
|
SMC-432D |
Stressmarq |
0.1mg |
EUR 423.6 |
|
|
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated. |
Human Monoclonal Laboratories manufactures the mono clonals reagents distributed by Genprice. The Mono Clonals reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact human monoclonal. Other Mono products are available in stock. Specificity: Mono Category: Clonals
Porcine True insulin ELISA kit |
|
BlueGene |
96T |
EUR 700 |
|
Description: ELISA |
Goat True insulin ELISA kit |
|
BlueGene |
96T |
EUR 700 |
|
Description: ELISA |
Biology information
Anti-c-FOS Rabbit clonal antibody |
|
MBS684315-005mL |
MyBiosource |
0.05mL |
EUR 475 |
Anti-c-FOS Rabbit clonal antibody |
|
MBS684315-01mL |
MyBiosource |
0.1mL |
EUR 700 |
Anti-c-FOS Rabbit clonal antibody |
|
MBS684315-5x01mL |
MyBiosource |
5x0.1mL |
EUR 2855 |
pGreenFire 2.0 TCF/LEF clonal 293T reporter cell line (pGF2-TCF/LEF-rFluc-T2A-GFP-mPGK-Puro) |
|
TR413C-P |
SBI |
>2 x 10^6 cells |
EUR 3080 |
Anti-PD-1 FITC Rabbit clonal antibody |
|
MBS684310-01mL |
MyBiosource |
0.1mL |
EUR 245 |
Anti-PD-1 FITC Rabbit clonal antibody |
|
MBS684310-100Tests |
MyBiosource |
100Tests |
EUR 905 |
Anti-PD-1 FITC Rabbit clonal antibody |
|
MBS684310-5x100Tests |
MyBiosource |
5x100Tests |
EUR 3770 |
Anti–Annexin A1 Rabbit clonal antibody |
|
MBS684313-004mLConcentrate |
MyBiosource |
0.04mL(Concentrate) |
EUR 215 |
Anti–Annexin A1 Rabbit clonal antibody |
|
MBS684313-01mLConcentrate |
MyBiosource |
0.1mL(Concentrate) |
EUR 365 |
Anti–Annexin A1 Rabbit clonal antibody |
|
MBS684313-02mLConcentrate |
MyBiosource |
0.2mL(Concentrate) |
EUR 475 |
Anti–Annexin A1 Rabbit clonal antibody |
|
MBS684313-15mLRTU |
MyBiosource |
15mL(RTU) |
EUR 550 |
Anti–Annexin A1 Rabbit clonal antibody |
|
MBS684313-7mLRTU |
MyBiosource |
7mL(RTU) |
EUR 385 |
Melanosome (human) clonal antibody (P14-V) |
|
MBS566391-1mL |
MyBiosource |
1mL |
EUR 1315 |
Melanosome (human) clonal antibody (P14-V) |
|
MBS566391-5x1mL |
MyBiosource |
5x1mL |
EUR 5855 |
Anti-Annexin A1 FITC Rabbit clonal antibody |
|
MBS684311-01mL |
MyBiosource |
0.1mL |
EUR 245 |
Anti-Annexin A1 FITC Rabbit clonal antibody |
|
MBS684311-100Tests |
MyBiosource |
100Tests |
EUR 715 |
Anti-Annexin A1 FITC Rabbit clonal antibody |
|
MBS684311-5x100Tests |
MyBiosource |
5x100Tests |
EUR 2915 |
