November 10, 2024

Iga Monoclonal

Monoclonal antibody for SUR1 and SUR2B

SMC-432D 0.1mg
EUR 423.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated.

Iga Monoclonal Laboratories manufactures the iga monoclonal reagents distributed by Genprice. The Iga Monoclonal reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact iga monoclonal. Other Iga products are available in stock. Specificity: Iga Category: Monoclonal

True Blue Chloride

100mg
EUR 11200
Description: 71431-30-6

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 423.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 480
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 390.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 488.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 565.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 594.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 633.

Biology information

Mouse Anti Monkey Iga Monoclonal Antibody

DMABT-48823MM 0.25 mg
EUR 567
Description: Mouse

Mouse Anti Human Iga Monoclonal Antibody

CABT-48820MH 1 mg
EUR 546
Description: Mouse

Mouse Anti Horse Iga Monoclonal Antibody

DMABT-51963MH 2 ml
EUR 546
Description: Mouse

Mouse anti Human IgA Monoclonal Antibody

MBS460953-01mg 0.1mg
EUR 280

Mouse anti Human IgA Monoclonal Antibody

MBS460953-5x01mg 5x0.1mg
EUR 1215

Mouse anti Human IgA Monoclonal Antibody

MBS460954-01mg 0.1mg
EUR 280

Mouse anti Human IgA Monoclonal Antibody

MBS460954-5x01mg 5x0.1mg
EUR 1215

Human IgA (Total IgA) mouse monoclonal antibody, clone A909

1A1-A909 1 mg Ask for price

Mouse Anti Bovine Iga Monoclonal Antibody

DMABT-51899MB 0.25 mg
EUR 546
Description: Mouse

Mouse Anti Chicken Iga Monoclonal Antibody

DMABT-51958MC 0.25 mg
EUR 546
Description: Mouse

IgA (14V16) Rabbit Monoclonal Antibody

E28M5108 100ul
EUR 295

Monoclonal Anti-human IgA antibody.

TMI012-0.25MG 0.25mg
EUR 169
Description: Specific to human IgA, no cross reaction with IgE, IgG, and IgM. This antibody can be paired with TMI013.

Monoclonal Anti-human IgA antibody.

TMI012-1MG 1mg
EUR 569
Description: Specific to human IgA, no cross reaction with IgE, IgG, and IgM. This antibody can be paired with TMI013.

Monoclonal Anti-human IgA antibody.

TMI013-0.25MG 0.25mg
EUR 169
Description: Specific to human IgA, no cross reaction with IgE, IgG, and IgM. This antibody can be paired with TMI012.

Monoclonal Anti-human IgA antibody.

TMI013-1MG 1mg
EUR 569
Description: Specific to human IgA, no cross reaction with IgE, IgG, and IgM. This antibody can be paired with TMI012.

CD79a Recombinant monoclonal antibody (IGA/1790R)

MBS566843-01mg 0.1mg
EUR 615

CD79a Recombinant monoclonal antibody (IGA/1790R)

MBS566843-5x01mg 5x0.1mg
EUR 2720